DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and snk

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:267 Identity:88/267 - (32%)
Similarity:122/267 - (45%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IIGGRDAIINSNPWMAYI---------HSSVKLICGGTLITQRFVLTAAHCVNEGSAV--KVRLG 93
            |:||........|.||.:         ...:|..|||.|:::.:|||||||...||..  .||||
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250

  Fly    94 --EYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICII 156
              :.::|:....:.||.|          ...|.|:......:|||||:|.:.|.|...:.|.|: 
  Fly   251 ARQLNETSATQQDIKILI----------IVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACL- 304

  Fly   157 LGTSKRELVDSIEWFVATGWGET-----RTHRTRG-----VLQITQLQRYNSSQCMQALGRLVQQ 211
              ....||  .|...||.|||.|     :::..|.     |.|:|..|.|...   :.|.|.:.:
  Fly   305 --WQLPEL--QIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKE---RRLPRGIIE 362

  Fly   212 NQICAGRL--GSDTCNGDSGGPLFQTVRHMDKMRPVQF--GVVSYGSREC---SGIGVYTDVYSY 269
            .|.|||.|  |.|||.||||||:...   :.:...|.|  |:.|:| :.|   :..||||.:|||
  Fly   363 GQFCAGYLPGGRDTCQGDSGGPIHAL---LPEYNCVAFVVGITSFG-KFCAAPNAPGVYTRLYSY 423

  Fly   270 ADWIATV 276
            .|||..:
  Fly   424 LDWIEKI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 86/262 (33%)
Tryp_SPc 40..276 CDD:238113 88/265 (33%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 88/265 (33%)
Tryp_SPc 186..427 CDD:214473 86/262 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.