DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG13318

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:307 Identity:90/307 - (29%)
Similarity:134/307 - (43%) Gaps:57/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GAIAAITALAIGVLCSLG------NGEYLEPRCGL-----TANTIAFKIIGGRDAIINSNPWMAY 56
            |....:...:..:.||.|      .|.|   :||.     ..:|.|    ....|...:.||.|.
  Fly   122 GGYPTVPTTSSTLTCSYGLVACCQAGSY---QCGRRFPPPPGSTTA----APGQASFGAYPWQAA 179

  Fly    57 IHSSVKL-ICGGTLITQRFVLTAAHCV-NEG-SAVKVRLGEYDDTATEDCNSKICIPRAEEHDVD 118
            :.::..: :.||.|||.:.||||||.| |.| :..||||||:|..:|.:     .|| |::..:.
  Fly   180 LLTTADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSE-----PIP-AQDVYIS 238

  Fly   119 MAFRHGKFSEIKNLNDIALLRLAKFV--TFKAHISPICIILGTSKRELVDSIEWFVATGWGETRT 181
            ..:.:..|:.....||:|:|:|:..|  |.|:.:..:|:    .....|....|  ..|||:...
  Fly   239 NVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCL----PTTSFVGQRCW--VAGWGKNDF 297

  Fly   182 HRTRGVLQITQLQ-------RYNSSQCMQA--LGR---LVQQNQICA-GRLGSDTCNGDSGGPLF 233
            ..| |..|..:.|       ..|....:||  ||.   |...:.||| |..|.|.|.||.|.||.
  Fly   298 GAT-GAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLV 361

  Fly   234 QTVRHMDKMRPVQFGVVSYGSREC--SGI-GVYTDVYSYADWIATVV 277
            .|...:..:    .|:|::|. .|  :|: |||.:|.:|..||.|.:
  Fly   362 CTSNGVWYV----VGLVAWGI-GCAQAGVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 77/254 (30%)
Tryp_SPc 40..276 CDD:238113 79/256 (31%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 79/250 (32%)
Tryp_SPc 169..399 CDD:214473 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.