DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG7542

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:250 Identity:71/250 - (28%)
Similarity:109/250 - (43%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IIGGRDAIINSNPWMAYIHSSV---KLICGGTLITQRFVLTAAHCVNEGSAVKVRLGEYD-DTAT 100
            |..|..|.:...|:.|.::.|.   ...||||||:..:::|||||::...:|.|.||..: ...:
  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDES 91

  Fly   101 EDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKREL- 164
            |:...:|.:.::.      ...|..:.....:|||:|:||..||.|...|....:     .|.| 
  Fly    92 EEGQERIMVEKSG------IIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASL-----PRRLN 145

  Fly   165 -----VDSIEWFVATGWG--ETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRL-GS 221
                 .:||..| |:|||  ...:.....||:..::.....|.|.......|.:..||.... |.
  Fly   146 GQFPTYESIRAF-ASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGK 209

  Fly   222 DTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIG---VYTDVYSYADWI 273
            .||:|||||||.....:...:    .|..|:|:.....:|   |:|.:.||.|||
  Fly   210 STCHGDSGGPLVYKQGNSSYL----IGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 69/248 (28%)
Tryp_SPc 40..276 CDD:238113 70/249 (28%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 70/249 (28%)
Tryp_SPc 27..260 CDD:214473 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436329
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.