DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG11529

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:234 Identity:69/234 - (29%)
Similarity:105/234 - (44%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLICGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKF 126
            :::|||||:.:|::|||.||....:...|.||......||.....:.  |:.:..|     |.:|
  Fly    56 RILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVL--RSNKFIV-----HERF 113

  Fly   127 SEIKNLNDIALLRLAKFVTFKAHISPICI--------ILGTSKRELVDSIEWFVATGWGETRTHR 183
            :.....|||||::|.:.|.|...|.|..:        ..|.|          .||:|||......
  Fly   114 NPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMS----------VVASGWGAMVEMT 168

  Fly   184 TRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRLGSDT-CNGDSGGPLFQTVRHMDKMRPVQF 247
            ....:|.|:|:..::::|.|... :|....|||..|..:| |.|||||||      :.|...:..
  Fly   169 NSDSMQYTELKVISNAECAQEYD-VVTSGVICAKGLKDETVCTGDSGGPL------VLKDTQIVV 226

  Fly   248 GVVSYGSR---ECSGIGVYTDVYSYADWIATVVQQNTHV 283
            |:.|:|..   |.:..|.:|.|..|.|||.:.:..:..|
  Fly   227 GITSFGPADGCETNIPGGFTRVTHYLDWIESKIGSHGQV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 66/222 (30%)
Tryp_SPc 40..276 CDD:238113 68/225 (30%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 68/225 (30%)
Tryp_SPc 37..255 CDD:214473 66/222 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.