DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG18180

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:285 Identity:80/285 - (28%)
Similarity:114/285 - (40%) Gaps:54/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIAAITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIH-----SSVKL 63
            |:|.:.|...|:           .|..|.:.....:|:.|..|.....|::..:.     |:...
  Fly    11 ALALVAASPTGL-----------NRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGA 64

  Fly    64 ICGGTLITQRFVLTAAHCVNEGSAVKVRLGE-------YDDTATEDCNSKICIPRAEEHDVDMAF 121
            :..||:|...::||||||:. |..|::..|.       |..|...|  :.|..|       |...
  Fly    65 VGAGTIIANDWILTAAHCLT-GDYVEIHYGSNWGWNGAYRQTVRRD--NFISHP-------DWPS 119

  Fly   122 RHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIE--WFVATGWGETRTHRT 184
            :.|:        ||.|:| ...|.|...|:.|.:   .|..|..|..:  |.||.|||.......
  Fly   120 QGGR--------DIGLIR-TPHVDFNGLINKIPL---PSMNEQNDRYQDTWCVACGWGGMDNGNL 172

  Fly   185 RGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGV 249
            ...||...:|..::|:|.||.|.:...:.......|...|.|||||||   |.| |..|.|  ||
  Fly   173 ADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGGPL---VTH-DNARLV--GV 231

  Fly   250 VSYGSREC-SGIGVYTDVYSYADWI 273
            :::.|..| .|...||.|..|.:||
  Fly   232 ITFASVSCHDGPSGYTRVSDYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 72/248 (29%)
Tryp_SPc 40..276 CDD:238113 74/249 (30%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 72/248 (29%)
Tryp_SPc 36..259 CDD:238113 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.