DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG18179

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:292 Identity:84/292 - (28%)
Similarity:123/292 - (42%) Gaps:54/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALAIGVLCSLG-NGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYI-----HSSVKLICGGT 68
            |||: |..|.| |...|.|:..::..... :|:.|..|.....|::..:     .|:...:..||
  Fly    11 ALAV-VAASPGFNRTSLLPQVTISEGAEG-RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGT 73

  Fly    69 LITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHG--KFSEIKN 131
            :|...::||||||:.. ..|::..|                   .....:.|||..  :.:.|.:
  Fly    74 IIASDWILTAAHCLTT-DYVEIHYG-------------------SNWGWNGAFRQSVRRDNFISH 118

  Fly   132 LN-------DIALLRLAKFVTFKAHISPICI-ILGTSKRELVDSIEWFVATGWGETRTHRTRGVL 188
            .|       ||.|:|... |.|...|:.:.: .........||:  |.||.|||..........|
  Fly   119 PNWPAEGGRDIGLIRTPS-VGFTDLINKVALPSFSEESDRFVDT--WCVACGWGGMDNGNLADWL 180

  Fly   189 QITQLQRYNSSQCMQALGRLVQQNQICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSY 252
            |...:|..::|:|.|:.| .|....:|..|. |..:|.|||||||   |.| |..|.|  ||:::
  Fly   181 QCMDVQIISNSECEQSYG-TVASTDMCTRRTDGKSSCGGDSGGPL---VTH-DNARLV--GVITF 238

  Fly   253 GSREC-SGIGVYTDVYSYADWIATVVQQNTHV 283
            ||.:| ||...||.|..|..||    :.||.:
  Fly   239 GSVDCHSGPSGYTRVTDYLGWI----RDNTGI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 71/250 (28%)
Tryp_SPc 40..276 CDD:238113 73/252 (29%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 71/250 (28%)
Tryp_SPc 40..263 CDD:238113 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.