DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:283 Identity:88/283 - (31%)
Similarity:121/283 - (42%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIAAITALAI----GVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLI 64
            |..||.|||:    |........|.|.|   :....:..:|..|..|.....|:...:..|....
  Fly     3 AFIAILALAVASASGATMPRLATEKLTP---VHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWW 64

  Fly    65 CGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRH--GKFS 127
            |||::|...:||||.||:.:..:|.|..|     ||...|::              |.|  |..:
  Fly    65 CGGSIIAHDWVLTAEHCIGDADSVTVYFG-----ATWRTNAQ--------------FTHWVGNGN 110

  Fly   128 EIKNLN-DIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWF-VATGWGETRT-HRTRGVLQ 189
            .||:.: ||||:|: ..|.|...::.  :.|.:......|..||: ||.|||.|.. ......||
  Fly   111 FIKHSSADIALIRI-PHVDFWHMVNK--VELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQ 172

  Fly   190 ITQLQRYNSSQCMQALGRLVQQNQICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYG 253
            ...||..::|:|....|. |..|.:|.... |..||.|||||||   |.| |..:.|  ||.::|
  Fly   173 CVDLQIIHNSECSGYYGS-VGDNILCVRTPDGKSTCGGDSGGPL---VTH-DGTKLV--GVTNFG 230

  Fly   254 S-REC-SGIGV-YTDVYSYADWI 273
            | ..| ||... :..|..:.|||
  Fly   231 SVAGCQSGAPAGFQRVTYHLDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 76/242 (31%)
Tryp_SPc 40..276 CDD:238113 78/243 (32%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 76/242 (31%)
Tryp_SPc 40..256 CDD:238113 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.