DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:279 Identity:84/279 - (30%)
Similarity:115/279 - (41%) Gaps:45/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQ 72
            :|.||:.|..:......:.|:.......|..:|..|..|.....|:...:..|....|||::|:.
  Fly     5 LTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIISN 69

  Fly    73 RFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMA--FRHGKFSEIKNLNDI 135
            .:||||.||:. |.||.|..|     ||...|::.      .|.|...  ..||.       .||
  Fly    70 EWVLTAEHCIG-GDAVTVYFG-----ATWRTNAQF------THWVGSGNFITHGS-------ADI 115

  Fly   136 ALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWF-VATGWGETRT-HRTRGVLQITQLQRYNS 198
            ||:|: ..|.|...::.  :.|.:......|..||: ||.|||.|.. ......||...||..::
  Fly   116 ALIRI-PHVDFWHMVNK--VELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHN 177

  Fly   199 SQCMQALGR-LVQQNQICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIG 261
            |:|....|. .|..|.||...: |..||.|||||||   |.| |..:.|  ||.::    .||.|
  Fly   178 SECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPL---VTH-DGSKLV--GVTNW----VSGAG 232

  Fly   262 V-------YTDVYSYADWI 273
            .       :..|..:.|||
  Fly   233 CQAGHPAGFQRVTYHLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 76/246 (31%)
Tryp_SPc 40..276 CDD:238113 78/247 (32%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 76/246 (31%)
Tryp_SPc 37..254 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.