DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG10469

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:267 Identity:72/267 - (26%)
Similarity:115/267 - (43%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TIAFKIIGGRDAIINSNPW----MAYIHSS--VKLICGGTLITQRFVLTAAHCVNEGSA----VK 89
            |.:.:|:.|..|.....|:    :.|...|  ...:||||:::.|:::|||||:.:..:    |.
  Fly    19 TGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVL 83

  Fly    90 VRLGE---YDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHIS 151
            :.:|:   :||       .:|.:.|:      ....|.||......|||||::|.|.:||..:|.
  Fly    84 IHVGKVKSFDD-------KEIVVNRS------YTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQ 135

  Fly   152 PICIILG----TSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQC----MQALG-- 206
            |..:...    |.::.::        :|||.|.......|||..:....::.:|    .:.||  
  Fly   136 PAKLPSAKKTYTGRKAII--------SGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGK 192

  Fly   207 --RLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYG-SREC--SGIGVYTDV 266
              ::|....||........|.||||||:.     :|.......|:||:| ..||  ....|.|.|
  Fly   193 SKKVVHNGFICIDSKKGLPCRGDSGGPMV-----LDDGSRTLVGIVSHGFDGECKLKLPDVSTRV 252

  Fly   267 YSYADWI 273
            .||..||
  Fly   253 SSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 69/261 (26%)
Tryp_SPc 40..276 CDD:238113 71/262 (27%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 69/261 (26%)
Tryp_SPc 24..260 CDD:238113 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.