DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG6592

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:230 Identity:74/230 - (32%)
Similarity:105/230 - (45%) Gaps:26/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGTLITQRFVLTAAHCVNEGSAVKVRLGEYD-DTATEDCNSKICIPRAEEHDVDMAFRHGKFSE 128
            |||:||:.:.|:||||||:......|.||..: ..|.|....::.:| :|...:...:...:..:
  Fly   151 CGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVP-SENFQIYPTWNPKRLKD 214

  Fly   129 IKNLNDIALLRLAKFVTFKAHISPICI-----ILGTSKRELVDSIEWFVATGWGE--TRTHRTRG 186
                 |||::||...|:|...|.||.:     ...:.|.:|.      :|:|||.  |..|....
  Fly   215 -----DIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLA------IASGWGRYATGVHAISN 268

  Fly   187 VLQITQLQRYNSSQCMQALGRLVQQNQIC-AGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVV 250
            ||:..|||..:...|........:...|| :||....||||||||||....||..|.  |..|:.
  Fly   269 VLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKR--VLVGIT 331

  Fly   251 SYGSRECSGIG---VYTDVYSYADWIATVVQQNTH 282
            |:||......|   .:|.|.||.|||:.....:.|
  Fly   332 SFGSIYGCDRGYPAAFTKVASYLDWISDETGVSAH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 71/219 (32%)
Tryp_SPc 40..276 CDD:238113 73/222 (33%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 71/219 (32%)
Tryp_SPc 123..359 CDD:238113 73/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.