DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:259 Identity:66/259 - (25%)
Similarity:95/259 - (36%) Gaps:104/259 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGTLITQRFVLTAAHCVNEGSAVKVRLG-------EYDDTATEDCNSKICIPRAEEHDVDMA-- 120
            |||::|...:|:||.||.:...:|.:..|       :|                  .|.|..:  
  Fly    66 CGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQY------------------THWVGRSDF 112

  Fly   121 FRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIE--------------WF 171
            ..||.       .||:|:| ...|.|.:               ||:.:|              |.
  Fly   113 IEHGS-------GDISLIR-TPHVDFWS---------------LVNKVELPRYDDRYNNYQGWWA 154

  Fly   172 VATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRLGS--------------D 222
            :.:|||:|...  .||           |:.:..:...:.:|.:|....||              .
  Fly   155 LVSGWGKTSDE--GGV-----------SEYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKG 206

  Fly   223 TCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRE-C--SGIGVYTDVYSYADWIATVVQQNTHV 283
            ||:|||||||   |.| |..|  |.|:||:||.. |  :|......|.||.|||    :.||.:
  Fly   207 TCSGDSGGPL---VIH-DGNR--QVGIVSFGSSAGCLSNGPKGMVRVTSYLDWI----RDNTGI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 62/247 (25%)
Tryp_SPc 40..276 CDD:238113 64/250 (26%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 62/247 (25%)
Tryp_SPc 41..257 CDD:238113 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.