DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:290 Identity:87/290 - (30%)
Similarity:129/290 - (44%) Gaps:31/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAAITALAIGVLCS--LGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPW---MAYIHSSVKLI 64
            :..:.|||:....:  |.....:.||.......|..:|..|:.|.....|:   :::..:|....
  Fly     3 VLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWW 67

  Fly    65 CGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEI 129
            |||::|...:|||||||.:..|||.:..|     ||...::::    .:....|...:|..::.|
  Fly    68 CGGSIIDNTWVLTAAHCTSGASAVTIYYG-----ATVRTSAQL----VQTVSADNFVQHASYNSI 123

  Fly   130 KNLNDIALLRLAKFVTFKAHISPICI--ILGTSKRELVDSIEWFVATGWGETRTHRT--RGVLQI 190
            ...|||:|:: ...|.|.|.|:.:.:  |.||..   ..:.:..:|:|||:|....|  ...||.
  Fly   124 VLRNDISLIK-TPTVAFTALINKVELPAIAGTYS---TYTGQQAIASGWGKTSDSATSVANTLQY 184

  Fly   191 TQLQRYNSSQCMQALGRLVQQNQ-ICAGRLGS-DTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYG 253
            ...:..:.|||....|.||..|. ||...... .||||||||||  .:....|:..|...|.|.|
  Fly   185 EVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPL--VLVSDSKLIGVTSFVSSAG 247

  Fly   254 SRECSGIGVYTDVYSYADWIATVVQQNTHV 283
            ....:..| :|.|.||.|||.|    ||.|
  Fly   248 CESGAPAG-FTRVTSYLDWIKT----NTGV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 74/242 (31%)
Tryp_SPc 40..276 CDD:238113 76/244 (31%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 74/242 (31%)
Tryp_SPc 40..269 CDD:238113 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.