DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG30414

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:304 Identity:106/304 - (34%)
Similarity:149/304 - (49%) Gaps:42/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAAITALAIGVLCSLGNGE-----YLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLI 64
            |||..||   ::||:..||     .|:..||.|.......|.||.||.:.|||||..:..  :.:
  Fly     4 IAAGLAL---LVCSIQLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKVLG--EKL 63

  Fly    65 CGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDT-ATEDCNSKI--------------------- 107
            |||:|||.|||||||||: ..:.::||||||... ..:||:..:                     
  Fly    64 CGGSLITSRFVLTAAHCI-VSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGK 127

  Fly   108 --CIPRAEEHDVDMAFRHGKFSEIKNL-NDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIE 169
              |:|::.|..||....|..::  .|| |||.|||:..||.:..::.|||:::   :..:.:| .
  Fly   128 DCCVPKSYELAVDRKILHADYN--LNLDNDIGLLRMKSFVQYSDYVRPICLLV---EGHMAES-P 186

  Fly   170 WFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQ 234
            .|..||||.|........||...:...:...|.....:.|.::||||....||.|:|||||||..
  Fly   187 IFNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSA 251

  Fly   235 TVRHMDKMRPVQFGVVSYGSRECSGIGVYTDVYSYADWIATVVQ 278
            .|.........|:|:|||||..|....|||:|..:.|||...::
  Fly   252 QVPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAIE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 91/258 (35%)
Tryp_SPc 40..276 CDD:238113 93/260 (36%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 91/257 (35%)
Tryp_SPc 41..290 CDD:238113 91/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.