DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and try-9

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:238 Identity:47/238 - (19%)
Similarity:78/238 - (32%) Gaps:84/238 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDC---------------------NSKICIP 110
            |||::...::||||.:.           ..:....||                     |....:|
 Worm    30 GTLVSPWHIVTAAHLIG-----------ISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVP 83

  Fly   111 RAEE--HDVDM---------AFRHGKFS----EIKNLNDIALLRLAKFVTFKAHISPICIILGTS 160
            ...:  |..||         ..|.|...    :.::.||||:..|.:.:.|...|.|.|:.....
 Worm    84 EMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACLPSAPK 148

  Fly   161 KRELVDSIEWFVATGWGETRTHRTRGVLQITQLQR-------------YNSSQCMQALGRLVQQN 212
            ...:.::  .:...|:|...:.   .||:..:|:.             |....|..|:.|.:   
 Worm   149 IPRIRET--GYKLFGYGRDPSD---SVLESGKLKSLYSFVAECSDDFPYGGVYCTSAVNRGL--- 205

  Fly   213 QICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQ--FGVVSYG 253
                      :|:||||..:.:|    ...|.||  .||:|.|
 Worm   206 ----------SCDGDSGSGVVRT----SDTRNVQVLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 47/238 (20%)
Tryp_SPc 40..276 CDD:238113 47/238 (20%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 47/238 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.