DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG4650

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:277 Identity:93/277 - (33%)
Similarity:141/277 - (50%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALAIGVLCSL------GNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKL-ICGG 67
            ::.||:...|      |:.:||:.||||..|        |:.|...|:|||||:|:|..| :|||
  Fly     3 SVVIGISALLFLLPVPGSSQYLDGRCGLLTN--------GKIANNISSPWMAYLHTSELLYVCGG 59

  Fly    68 TLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNL 132
            |:||::.|||||||......:..|:||:  ..|:|.|..:    ..|:.|...|.|..::...:.
  Fly    60 TVITEKLVLTAAHCTRASEQLVARIGEF--IGTDDANDTM----LSEYQVSQTFIHSLYNTTTSA 118

  Fly   133 NDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYN 197
            ||||:|.||..:.|...|.||||:..|..|:.:|:|:......||...........:||.::|..
  Fly   119 NDIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQP 183

  Fly   198 SSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGV 262
            ::.|....|..:..:|.|||...|..||.|...||...:...:..|.|..|:.: .:::|....|
  Fly   184 ANMCSTLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKCKRASV 247

  Fly   263 YTDVYSYADWIATVVQQ 279
            ||||.|:.|:|.:|.:|
  Fly   248 YTDVLSHTDFILSVWRQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 79/234 (34%)
Tryp_SPc 40..276 CDD:238113 80/236 (34%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 80/239 (33%)
Tryp_SPc 33..258 CDD:304450 80/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.