DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and psh

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:277 Identity:94/277 - (33%)
Similarity:128/277 - (46%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TANTIAFKIIGGRDAIINSNPWMA---YIHSSVKLICGGTLITQRFVLTAAHCVN--EGSAVKVR 91
            :.|.:...|:||........|.||   ||.......|||:||..|||||||||||  ..:...||
  Fly   136 SGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVR 200

  Fly    92 LG----EYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISP 152
            ||    |..|.:.:|    |.|...:.|...:..::         ||||:|.|.:.|....:|.|
  Fly   201 LGAVNIENPDHSYQD----IVIRSVKIHPQYVGNKY---------NDIAILELERDVVETDNIRP 252

  Fly   153 ICIILGTSKRELVDSIEWFVATGWG----ETRTHR---TRGVLQITQLQRYNSSQCMQALG-RLV 209
            .|  |.|...:...:.::||| |||    .||...   .|..|::..|.:.|.|...|... ||:
  Fly   253 AC--LHTDATDPPSNSKFFVA-GWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLL 314

  Fly   210 QQNQI----CA--GRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGI--GVYTDV 266
            :|..|    ||  .:|.:|.|.|||||||...:...|.|..: .||:|.|. .|:.:  |:||.|
  Fly   315 KQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTI-MGVISSGF-GCATVTPGLYTRV 377

  Fly   267 YSYADWIATVVQQNTHV 283
            .||.|:|..:|..:..|
  Fly   378 SSYLDFIEGIVWPDNRV 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 90/258 (35%)
Tryp_SPc 40..276 CDD:238113 91/260 (35%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 90/258 (35%)
Tryp_SPc 144..387 CDD:238113 91/260 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.