DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and Hayan

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:252 Identity:84/252 - (33%)
Similarity:113/252 - (44%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PWMAYI----HSSVKLICGGTLITQRFVLTAAHCVNEGSAVK--VRLG----EYDDTATEDCNSK 106
            |.||.|    ..|....|||:||..|||||||||||...:..  ||||    |..:...:|.|. 
  Fly   397 PHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPGYQDINV- 460

  Fly   107 ICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWF 171
                      :|:.. |..:|......|||:|:||:.......|.|.|  |.|.:.:...:.::|
  Fly   461 ----------IDVQI-HPDYSGSSKYYDIAILQLAEDAKESDVIRPAC--LYTDRSDPPANYKYF 512

  Fly   172 VATGWGETR-THRT------RGVLQITQLQRYNSSQCMQ-----ALGRLVQQNQICAG--RLGSD 222
            || |||... |:|.      |..|.:......|:|...|     .|.|.|..:|:||.  ....|
  Fly   513 VA-GWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKD 576

  Fly   223 TCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECS--GIGVYTDVYSYADWIATVV 277
            .|.|||||||...:..:|....: .||:|.|. .|:  ..|:||.|.|:.|:|..:|
  Fly   577 ACQGDSGGPLILEIDDVDGTYSI-VGVISSGF-GCATKTPGLYTRVSSFLDYIEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 82/246 (33%)
Tryp_SPc 40..276 CDD:238113 83/249 (33%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 82/246 (33%)
Tryp_SPc 385..630 CDD:238113 83/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.