DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and sphe

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:270 Identity:69/270 - (25%)
Similarity:115/270 - (42%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEPR------CGLTANTIAF---KIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFVLTAAH 80
            ::||      .||||..:..   :|:||.||...:..:.|.:......:|||::::|..:||.||
  Fly     2 MQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAH 66

  Fly    81 CVN------EGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLR 139
            ||:      :.|.:..|:|..:..|    ..||.       :|:....|..:..:.  |::|::.
  Fly    67 CVHRDGKLIDASRLACRVGSTNQYA----GGKIV-------NVESVAVHPDYYNLN--NNLAVIT 118

  Fly   140 LAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQA 204
            |:..:|:...|:.|.::  .|...|.......:..|||.|........::...|:....:.|:.|
  Fly   119 LSSELTYTDRITAIPLV--ASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDA 181

  Fly   205 LGRLVQQNQICAGRLGSDTCNGDSGGPLF--QTVRHMDKMRPVQFGVVSYGSRECSGIGVYTDVY 267
            .....:|:...|..|...||:||.||...  .|:..:     ..|.|.:.|||       |.||:
  Fly   182 YSDHDEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGL-----TNFVVGACGSR-------YPDVF 234

  Fly   268 ----SYADWI 273
                ||||||
  Fly   235 VRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 61/245 (25%)
Tryp_SPc 40..276 CDD:238113 63/246 (26%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/230 (25%)
Tryp_SPc 42..244 CDD:214473 55/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.