DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG9676

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:272 Identity:67/272 - (24%)
Similarity:107/272 - (39%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLCSLG----NGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFV 75
            |||:.|    |...:|||           |:||..|.....|....:.......|||::|::.:|
  Fly    10 VLCAAGVLAQNDSVVEPR-----------IVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYV 63

  Fly    76 LTAAHCVNEGSAVKVRLGEYDDTATE---DCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIAL 137
            :||||||.:|:.|.        .|.|   ...|.:.........|.....|..::  .|.:|:|:
  Fly    64 VTAAHCVKQGNNVA--------PANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAV 118

  Fly   138 LRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWG--ETRTHRTRGVLQITQLQRYNSSQ 200
            |||...:||.::|:.|.:.......:....|     :|||  ..|...:..:|.: |::..:...
  Fly   119 LRLRNSLTFNSNIAAIKLATEDPPNDATVDI-----SGWGAISQRGPISNSLLYV-QVKALSRES 177

  Fly   201 CMQALGRLVQQNQIC-AGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGV-- 262
            |.:...|.:.:..:| ........|.||||||    ..:..|:    .|:.|:....|.....  
  Fly   178 CQKTYLRQLPETTMCLLHPKDKGACYGDSGGP----ATYQGKL----VGLASFVIGGCGRAAPDG 234

  Fly   263 YTDVYSYADWIA 274
            |..|....:|||
  Fly   235 YERVSKLRNWIA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 56/241 (23%)
Tryp_SPc 40..276 CDD:238113 59/243 (24%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 57/252 (23%)
Tryp_SPc 28..248 CDD:238113 59/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12259
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.