DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG31269

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:295 Identity:82/295 - (27%)
Similarity:117/295 - (39%) Gaps:64/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAAITALAIGVLCSLGN---GEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYI------HSS 60
            :.:|||:.|     .||   |.:.:.:          :||||:.|.....|:...:      || 
  Fly    15 LVSITAIRI-----KGNSTDGRFYKDQ----------RIIGGQAAEDGFAPYQISLQGISGAHS- 63

  Fly    61 VKLICGGTLITQRFVLTAAHCVNEG----SAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAF 121
                |||.:|.:.|||||||||...    ..|.....:|:..........|.|            
  Fly    64 ----CGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI------------ 112

  Fly   122 RHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRG 186
             |..:...:..||||||.|.:.:.:.....||.:.|  ...:..|.:   :.||||.|....|..
  Fly   113 -HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL--VPMQPGDEV---ILTGWGSTVLWGTSP 171

  Fly   187 V-LQITQLQRYNSSQCMQALG--RLVQQNQICA-GRLGSDTCNGDSGGPLFQTVRHMDKMRPVQF 247
            : ||:..||.....:|...|.  .......||. .|||...|:|||||||..        .....
  Fly   172 IDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVS--------NGYLV 228

  Fly   248 GVVSYGSRECSGI-GVYTDVYSYADWIATVVQQNT 281
            |:|::|....:|: .|:..||.|.|||..|:..|:
  Fly   229 GLVNWGWPCATGVPDVHASVYFYRDWIRNVMSGNS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 71/248 (29%)
Tryp_SPc 40..276 CDD:238113 73/250 (29%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/248 (29%)
Tryp_SPc 38..258 CDD:238113 73/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.