DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and sphinx1

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:297 Identity:56/297 - (18%)
Similarity:98/297 - (32%) Gaps:81/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITALAIGVLCSLGNGEYLEPRC--GLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLI--CGGT 68
            :|.|.:.:..|:|....|.||.  |..|.|.....:.|          :.|..|....:  ..||
  Fly     5 VTLLVLSLTVSVGEKNKLSPRIAGGYRAKTFTIIYLVG----------IVYFKSQTSSLNYGAGT 59

  Fly    69 LITQRFVLTAAHCVNEGSAVKVRLG---EYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIK 130
            :|:.:::|| ...|.:.|.::|.|.   .|                 ...|:...::........
  Fly    60 IISNQWILT-VKTVLKYSYIEVHLASRRSY-----------------RGFDIIRIYKENFRFHYD 106

  Fly   131 NLNDIALLRL------------------AKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWG 177
            |.:.|||::.                  .:|..:..:::.:| ..||.||. ....||       
  Fly   107 NDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVC-GYGTEKRH-AKLPEW------- 162

  Fly   178 ETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKM 242
                      ::..:::..|:::|.:....|.......:|......|.||.||.:...     ..
  Fly   163 ----------MRCIEVEVMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTM-----GP 212

  Fly   243 RPVQFGVVSYGSRECSGIG---VYTDVYSYADWIATV 276
            .|...|::......|| ||   |:..|..:..||..|
  Fly   213 NPTFIGIIWLMPENCS-IGYPSVHIRVSDHIKWIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 43/259 (17%)
Tryp_SPc 40..276 CDD:238113 45/261 (17%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 47/272 (17%)
Tryp_SPc 26..248 CDD:304450 48/274 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.