DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and spirit

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:267 Identity:84/267 - (31%)
Similarity:118/267 - (44%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IIGGRDAIINSNPWMAYI------HSSVKLICGGTLITQRFVLTAAHCVNEGS--AVKVRLGEYD 96
            ::||........|:||.:      ...:...|||.||...||||||||.:.|.  ..:||||..:
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196

  Fly    97 DTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSK 161
            .|.||          .|:..:.....|..:|.....||||||.|.  ...|..:.|.||   .::
  Fly   197 LTLTE----------GEDISIRRVIIHPDYSASTAYNDIALLELE--TAAKPELKPTCI---WTQ 246

  Fly   162 RELVDSIEWFVATGWGETR-THRTRGVLQITQLQRYNSSQCM-----QALGRLVQQNQICAGRLG 220
            :|:.:::  ..|.|:|:|. ...:...|....|:..::.:|.     ..|.:.|...|:|||.:.
  Fly   247 KEVTNTL--VTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDIT 309

  Fly   221 S--DTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSG-IGVYTDVYSYADWIATVV---QQ 279
            .  |||.|||||||..    .|.:.....|:.|.|....|| ..|||.|.|:.|||..:|   ||
  Fly   310 GERDTCQGDSGGPLLM----QDGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQQ 370

  Fly   280 NTHVPAP 286
            .|:.|.|
  Fly   371 VTNAPQP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 76/249 (31%)
Tryp_SPc 40..276 CDD:238113 78/252 (31%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 78/252 (31%)
Tryp_SPc 132..361 CDD:214473 76/249 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437450
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.