DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG33225

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:287 Identity:111/287 - (38%)
Similarity:154/287 - (53%) Gaps:18/287 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAAITALAIGVL-CSLGNGEYLEPRCGLTANTIAF-KIIGGRDAIINSNPWMAYIHSSVKLICGG 67
            :|.|..||..|| ..||:...|...||.|.:.... :::||.||...:||||..:.....:.|.|
  Fly    20 VAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSG 84

  Fly    68 TLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFS-EIKN 131
            :|||:.||||:|.|: .....:|.|||||    .:|.|..|....:..|:|....||:|. |...
  Fly    85 SLITRLFVLTSASCL-LSLPKQVILGEYD----RNCTSADCTSIRQVIDIDQKIIHGQFGLETVK 144

  Fly   132 LNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRY 196
            ..|||||||||.|:...::.|||:   :..|::..|::.|.|||||.|..:....:||...|.:.
  Fly   145 KYDIALLRLAKKVSISDYVRPICL---SVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKI 206

  Fly   197 NSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTV------RHMDKMRPVQFGVVSYGSR 255
            |...|...|.:.:..:|:|.|....|||:||:||||..|:      :..:|.|....|:|||||.
  Fly   207 NRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSS 271

  Fly   256 ECSGIGVYTDVYSYADWIA-TVVQQNT 281
            .||||||||:|..|.|||. |:.:.||
  Fly   272 SCSGIGVYTNVEHYMDWIVRTINKSNT 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 94/240 (39%)
Tryp_SPc 40..276 CDD:238113 96/243 (40%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 94/240 (39%)
Tryp_SPc 57..292 CDD:238113 96/242 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.