DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG33459

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:256 Identity:108/256 - (42%)
Similarity:139/256 - (54%) Gaps:15/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEPRCGLTANTIAF--KIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFVLTAAHCV-NEGS 86
            |||.||    .|.|  :|.||.||.:.|.||||::|:.::.:|||:|||..||||||||| ....
  Fly    25 LEPNCG----QIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPK 85

  Fly    87 AVKVRLGEYDDTATED-CNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHI 150
            .:.|||||||.|...| .|.|   .|..|:.|...:.|..:..|. ..|||||:|.:.|.:...|
  Fly    86 NLTVRLGEYDWTRQMDSINPK---HRHREYMVTRIYTHPSYRSIA-AYDIALLKLNQTVEYTVAI 146

  Fly   151 SPICIILGTSKRE---LVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQN 212
            .|||::|..:..|   ||||:|.|..||||.|:|.....|||...|.:.:...|....|..|...
  Fly   147 RPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGHSVDHT 211

  Fly   213 QICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGVYTDVYSYADWI 273
            .||||...|..|.||||.||...|.|..:....|.|:||.|.:.|.|:.|:|:|.|:.:||
  Fly   212 HICAGSSKSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 99/238 (42%)
Tryp_SPc 40..276 CDD:238113 101/239 (42%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 99/238 (42%)
Tryp_SPc 38..272 CDD:238113 99/237 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.