DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG33458

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:281 Identity:104/281 - (37%)
Similarity:156/281 - (55%) Gaps:7/281 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIAAITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGT 68
            |:.|:..|..|:  |||....||..||::..|  ::|.||||:.:..|||:||:|.:.|.||||:
  Fly     6 ALLALLILGHGI--SLGYSYLLEWDCGISKYT--YRITGGRDSPLMLNPWLAYLHINSKFICGGS 66

  Fly    69 LITQRFVLTAAHCVNEGSA-VKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNL 132
            |:...||||||||..:.:| |.|||||.|.:...|||...|.....|:.:.....|..: ...:.
  Fly    67 LLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLY-RTAHY 130

  Fly   133 NDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYN 197
            .||||.:|.::|.:...|.|||::|..:.:..||:|.:|:.||||.|........||:|::.:.:
  Fly   131 YDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQID 195

  Fly   198 SSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGV 262
            ...|....|.:|.:..||||........|||||||...|.:....|..|||:||:..:...|:.|
  Fly   196 RFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSV 260

  Fly   263 YTDVYSYADWI-ATVVQQNTH 282
            :|::.||::|| .|::..:.|
  Fly   261 FTNILSYSNWIHRTIITNSGH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 88/234 (38%)
Tryp_SPc 40..276 CDD:238113 90/237 (38%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 88/234 (38%)
Tryp_SPc 38..274 CDD:238113 90/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.