DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG33462

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:274 Identity:103/274 - (37%)
Similarity:141/274 - (51%) Gaps:9/274 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LAIGVLCSL-----GNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLI 70
            :.|.|:|.|     |....||..||:..|.....:    :|.:..||||||:.:.....|.||||
  Fly     6 IGIAVICCLWRRVQGFQMLLEEDCGIPHNISERSV----NAKLAQNPWMAYLETPKGFHCSGTLI 66

  Fly    71 TQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDI 135
            ...|||||||||.:...:.||||||:.....||::.:|....:|::|||.|||..::.....|||
  Fly    67 NHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDI 131

  Fly   136 ALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQ 200
            .:|||.:.|.:..||.||||......:|.:|.:.||..|.|.||..:.|..||:...:.|.....
  Fly   132 GMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKET 196

  Fly   201 CMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGVYTD 265
            |.:..|..:...|||||...|..|:.|||.|..:.:.|....|.||.|:.|....:|...|:..|
  Fly   197 CSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMD 261

  Fly   266 VYSYADWIATVVQQ 279
            :.||||||..||:|
  Fly   262 LLSYADWIKRVVRQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 88/233 (38%)
Tryp_SPc 40..276 CDD:238113 90/235 (38%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 88/223 (39%)
Tryp_SPc 48..269 CDD:214473 86/220 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463330
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.