DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG33461

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:278 Identity:106/278 - (38%)
Similarity:147/278 - (52%) Gaps:13/278 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITALAIGVLCSLGNGE-YLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLIT 71
            |..||:.||...|:.. :||..||:... :::|||.|..|.:...||||::|:....:|.|:||.
  Fly    10 IAYLALFVLGVHGSSSVFLEENCGVVPR-LSYKIINGTPARLGRYPWMAFLHTPTYFLCAGSLIN 73

  Fly    72 QRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIA 136
            |.||||:|||:.:...:..||||.:.....||.:..|:...:|::|||.|:|..:......|||.
  Fly    74 QWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIG 138

  Fly   137 LLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTH---RTRGVLQITQLQRYNS 198
            :|||.:.|.:..||.||||......:.:||.|.||.|||||.|.|.   ::..||....|.|...
  Fly   139 MLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPR 203

  Fly   199 SQCMQALGRLVQQN----QICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSG 259
            :.|    .|:.:||    |||||....:.|.||||||..:.|......|.||.|:.|:....||.
  Fly   204 NDC----ARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSK 264

  Fly   260 IGVYTDVYSYADWIATVV 277
            :.:.|||..|..||..||
  Fly   265 VSILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 92/240 (38%)
Tryp_SPc 40..276 CDD:238113 93/242 (38%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 92/240 (38%)
Tryp_SPc 42..281 CDD:238113 93/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463342
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
98.790

Return to query results.
Submit another query.