DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG30289

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:279 Identity:106/279 - (37%)
Similarity:150/279 - (53%) Gaps:25/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAAITALAI---GVLCSLGNGEYLEPRCGLTA-NTIAFKIIGGRDAIINSNPWMAYIHSSVKLIC 65
            |||:..|.|   .|:..|     |...||::. :.....|.||....|..||||..:.||..  |
  Fly     8 IAALVCLFIANNNVMSRL-----LVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP--C 65

  Fly    66 GGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATED----CNSKICIPRAEEHDVDMAFRHGKF 126
            ||:||.::|||||||||: ...:.||||:|:   |.|    |.:..|||:.....|||...|..:
  Fly    66 GGSLIARQFVLTAAHCVS-FEDLYVRLGDYE---TLDPMPYCLNNHCIPKFYNISVDMKIVHENY 126

  Fly   127 SEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQIT 191
            :.|...|||||||:::.|.:..::.|||:::|    |.:.||..|..||||||...:...:|...
  Fly   127 NGITLQNDIALLRMSEAVEYSDYVRPICLLVG----EQMQSIPMFTVTGWGETEYGQFSRILLNA 187

  Fly   192 QLQRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRE 256
            .|...:.|.|.....:...::|||||...|:||.|||||||.....:.:::...|:|:|||||..
  Fly   188 TLYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSER 252

  Fly   257 CSG--IGVYTDVYSYADWI 273
            |:.  .||||:|..:.:||
  Fly   253 CAANVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 94/239 (39%)
Tryp_SPc 40..276 CDD:238113 96/240 (40%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 94/238 (39%)
Tryp_SPc 42..271 CDD:238113 94/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.770

Return to query results.
Submit another query.