DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG30287

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:283 Identity:109/283 - (38%)
Similarity:158/283 - (55%) Gaps:7/283 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GAIAAITALAIGVLCSLGNGEYLEPRCGLTANTI--AFKIIGGRDAIINSNPWMAYIHSSVKLIC 65
            ||:..:..:|:..|...|....|:|:| :||.:.  .:::|.|:.|.:.|||||..|.....:.|
  Fly     4 GAVQLLLLIALVFLKVQGQPHLLDPQC-VTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKC 67

  Fly    66 GGTLITQRFVLTAAHCVNE-GSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEI 129
            ||:|||.|:|||||||.:| .|.:.||||:||.....||:|..||||..|.:|...:....::..
  Fly    68 GGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNF 132

  Fly   130 KNLNDIALLRLAKFVTFKAHISPICIILG--TSKRELVDSIEWFVATGWGETRTHRTRGVLQITQ 192
            :. ||||||||...|.:..:|..||:::|  |....::.::..|..||||.|.:.....|||...
  Fly   133 RK-NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQAS 196

  Fly   193 LQRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSREC 257
            |..::.|.|.|..|:.:.::.||.......||.|||||||...||...:.|.:.|||||||:..|
  Fly   197 LTHHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC 261

  Fly   258 SGIGVYTDVYSYADWIATVVQQN 280
            .|..|||:|..:|:||....::|
  Fly   262 FGPTVYTNVIHFANWIELHTKKN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 96/236 (41%)
Tryp_SPc 40..276 CDD:238113 98/238 (41%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 96/236 (41%)
Tryp_SPc 42..280 CDD:238113 98/238 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.