DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG30286

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:262 Identity:103/262 - (39%)
Similarity:160/262 - (61%) Gaps:5/262 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EYLEPRCG-LTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFVLTAAHCVNEGS 86
            ::|||.|| ::...:..:   ...|.|:.:|||||:|.|.:|:|||||:..||:||||||:.|..
  Fly    20 QFLEPDCGYMSPEALQNE---EHQAHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCIREDE 81

  Fly    87 AVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHIS 151
            .:.|||||::...:.|||...|:|.:|:.::|:|||||.:|....::||.||||||.|.:|.||.
  Fly    82 NLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIK 146

  Fly   152 PICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQNQICA 216
            |||:|..|:.:..::.:...||||||.:.:.....:|:..::.|.|...|.:......:::|||.
  Fly   147 PICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQICV 211

  Fly   217 GRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGVYTDVYSYADWIATVVQQNT 281
            ......:|:||||||:.|.:|...::..||.|:||||:.||....|:|:|..:.|||...: ..|
  Fly   212 SHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSVFTNVMEHIDWIMAAL-STT 275

  Fly   282 HV 283
            |:
  Fly   276 HI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 94/233 (40%)
Tryp_SPc 40..276 CDD:238113 96/235 (41%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 95/229 (41%)
Tryp_SPc 39..268 CDD:214473 94/228 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463280
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.