DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG30187

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:270 Identity:105/270 - (38%)
Similarity:141/270 - (52%) Gaps:24/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFVLTAAH 80
            |..:|...:|:..||:   .||.||.||.:|...::.|||.:|:....|||||||.:||||||||
  Fly    15 LKDVGASIFLDQICGI---NIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAH 76

  Fly    81 CVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFS-EIKNLNDIALLRLAKFV 144
            |:.:.....|.||.|:.:           ..|:..||..|..|..|. .....|||.||:|:..|
  Fly    77 CIVDQDVQSVSLGAYNKS-----------DPADRKDVITAVVHSSFDVRASYENDIGLLKLSSDV 130

  Fly   145 TFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLV 209
            .|.|.|.||||:|..|....:.::..|.|.|||..|.::|..:||...|...:..:|...|....
  Fly   131 IFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYP 195

  Fly   210 QQNQICAGRLGSDTCNGDSGGPL-----FQTVRHMDKMRPVQFGVVSYGSRECSGIGVYTDVYSY 269
            .:.|||||....|||.|||||||     .|.:.:    |.||||::|.|...|.|.|||||:.|:
  Fly   196 SEKQICAGVPSGDTCGGDSGGPLTNDVFIQGIGN----REVQFGIISVGKTSCDGQGVYTDLMSF 256

  Fly   270 ADWIATVVQQ 279
            ||||...:::
  Fly   257 ADWIKMTIER 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 96/239 (40%)
Tryp_SPc 40..276 CDD:238113 97/241 (40%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 96/239 (40%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I7012
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.