DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG30083

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:275 Identity:112/275 - (40%)
Similarity:152/275 - (55%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYI-----HSSVKLICGGTLITQRFVLTAAHCV 82
            ::|||.||..  .|:.||:.|::|...:|||||||     ....:|:||||||.::|||:||||:
  Fly    19 QFLEPNCGYP--DISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCI 81

  Fly    83 NEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFK 147
            .....:.|||||:..              :....|..|||:..|:.....|||.:||:...|.|.
  Fly    82 KRDQILAVRLGEHSS--------------SRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFN 132

  Fly   148 AHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQN 212
            |.|.|||||...:|   |.:::.|.|.|||:|.......||:..:|...|:|:|...|...|.::
  Fly   133 AVIRPICIITDPTK---VPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTES 194

  Fly   213 QICAGRLGSDTCNGDSGGPLFQTVRHMD-KMRPVQFGVVSYGSRECSGIGVYTDVYSYADWIATV 276
            |||||....|||.|||||||...| :|| .:|.||.|::|:||..|:..||||.:.|:.|||..|
  Fly   195 QICAGHPDGDTCAGDSGGPLIHPV-YMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFIDWILMV 258

  Fly   277 VQQNTHVPAPIMPNI 291
            |...| |.:|  |.|
  Fly   259 VDNYT-VRSP--PKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 97/239 (41%)
Tryp_SPc 40..276 CDD:238113 98/241 (41%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 97/239 (41%)
Tryp_SPc 34..255 CDD:238113 96/238 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463256
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.690

Return to query results.
Submit another query.