DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and try-3

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:269 Identity:82/269 - (30%)
Similarity:121/269 - (44%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AFKIIGGRDAIINSNPWMA----YIHSSVKLICGGTLITQRFVLTAAHC---VNEGSAVKVRLGE 94
            :|:|||| ::|.:...|||    |..:...::||.|:|...:::|||||   :...|.|.||   
 Worm    35 SFRIIGG-NSIDDGANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCALQLQTRSFVYVR--- 95

  Fly    95 YDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGT 159
                  |..|:     |.....|..|:.|..::.....|||||||::..:: |..|.|:|::...
 Worm    96 ------EPKNN-----RERSFSVKEAYIHSGYNNQTADNDIALLRISSDLS-KLGIKPVCLVHDD 148

  Fly   160 SKRELVDSIEWFVATGWGETRTHRTRG--------VLQITQLQRYNSSQCMQA------LGRLVQ 210
            ||  |:...:..|..|:|.|....:.|        .||.|.:...:...|::.      |...:.
 Worm   149 SK--LLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKIT 211

  Fly   211 QNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGI-------GVYTDVYS 268
            ..|||||.....|..|||||||   :.|......||.|:.|||:....|:       ||||.:..
 Worm   212 GYQICAGAYLHGTAPGDSGGPL---LIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISK 273

  Fly   269 YADWIATVV 277
            |..||..|:
 Worm   274 YVPWIQGVI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 78/261 (30%)
Tryp_SPc 40..276 CDD:238113 80/263 (30%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 79/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.