DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG43742

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:265 Identity:104/265 - (39%)
Similarity:140/265 - (52%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFVLTAAHCVNEGSA 87
            :.|:..|.:   .|.:::..|..||  ::.:||.::::.:..|||:||.:::||||||||.:...
  Fly    21 QLLDENCKV---KITYRVANGHTAI--TSQFMAALYNNSEFFCGGSLIHKQYVLTAAHCVRDLDE 80

  Fly    88 VKVRLGEYDDTATEDCNSKICIPRAEEHDVDM---AFRHGKFSEIKNLNDIALLRLAKFVTFKAH 149
            |.|.|||.:    ..|...:|     :|.:.:   ...|..|.....|||||||||.:.|.|:||
  Fly    81 VTVHLGENN----RSCPIPVC-----KHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAH 136

  Fly   150 ISPICIILG---TSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQ 211
            |.||||||.   ||..:     ..|.|.|||:|.......||....|.|...|.|.|.:      
  Fly   137 IRPICIILDEDVTSNNQ-----NNFTAYGWGKTEHGNISDVLSFIDLVRLPKSMCYQNI------ 190

  Fly   212 NQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGI-GVYTDVYSYADWIAT 275
            |.||||....|||..||||||.....|..|.|.:.||:.|||..||||: ||||||.:|..|||:
  Fly   191 NTICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVYTDVNAYKSWIAS 255

  Fly   276 VVQQN 280
            ||.::
  Fly   256 VVLES 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 96/240 (40%)
Tryp_SPc 40..276 CDD:238113 99/242 (41%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 96/240 (40%)
Tryp_SPc 35..256 CDD:238113 99/242 (41%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463443
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.