DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG43336

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:277 Identity:103/277 - (37%)
Similarity:156/277 - (56%) Gaps:5/277 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ITALAIGVLCSLGNGEYLEPRCGLTANTIAF-KIIGGRDAIINSNPWMAYIHSS-VKLICGGTLI 70
            :..|...:|..||:.::|:..||:.|::.:. ::..|..|.:.|:||||::||: .:.||||:||
  Fly     5 VVGLTFFLLPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLI 69

  Fly    71 TQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDI 135
            |.|.|||||||..:.:.:..||||||....|.|:...|..|.|.. |:..|||..::.:....||
  Fly    70 TNRLVLTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAM-VERGFRHRHYNPMTMAYDI 133

  Fly   136 ALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQ 200
            |:|||.:.|.:..:|.||||::....|:.:||::....||||:|.:......|:...|.|.:...
  Fly   134 AILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKHPEV 198

  Fly   201 CMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGVYTD 265
            |.:.....:..||.|||...|:.||||||||:...:.:....|.||.|:.|:.:.:|..:.|:||
  Fly   199 CRRYATLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVMVSVFTD 263

  Fly   266 VYSYADWIATVVQQNTH 282
            |.||.|||..|  .|.|
  Fly   264 VMSYVDWILAV--HNYH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 90/234 (38%)
Tryp_SPc 40..276 CDD:238113 92/236 (39%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 90/234 (38%)
Tryp_SPc 40..271 CDD:238113 90/231 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463289
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
98.790

Return to query results.
Submit another query.