DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG43124

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:278 Identity:69/278 - (24%)
Similarity:106/278 - (38%) Gaps:71/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLCSL-----GNGEYLEPRCGLTANTIAFKIIGGRDAIINSN--PWMAYIHSSVKLICGGTLITQ 72
            |||.:     |:.:.||..|           :...:.|..|:  ||:|.|.|..|:||.|.||..
  Fly     8 VLCIVLMFYQGSAQTLEEDC-----------VDHMERINGSSYAPWLAEILSDSKVICAGALINN 61

  Fly    73 RFVLTAAHCVNEGSAVKVRLGE-YDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIA 136
            .:|||||.|..|...:.||||. |.|.:.|:..            |..|:.........|.|::.
  Fly    62 LYVLTAASCFKENEKLTVRLGSGYFDKSYENFR------------VTKAYFWMTHFPANNTNNLC 114

  Fly   137 LLRLAKFVTFKAHISPICIILGTSKRELVDSIE--------WFVATGWGETRTHRTRGVLQITQL 193
            :.||...|.||.||.|:||........|..:.|        |:..        ...:|:.     
  Fly   115 IFRLQTEVEFKTHIRPMCITKSPKSLGLATTFEIINEKPKMWYFC--------KNIKGLF----- 166

  Fly   194 QRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECS 258
                   |....|...::.|           :..:|.|..:|:.:......|::|::||...:..
  Fly   167 -------CKYVFGENEEKWQ-----------SKPTGSPWTETISNGPFKGLVRYGILSYRDNKTY 213

  Fly   259 GIGVYTDVYSYADWIATV 276
            . .||.:|.|:.:|||.:
  Fly   214 D-EVYINVMSHINWIAQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 59/244 (24%)
Tryp_SPc 40..276 CDD:238113 62/246 (25%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 37/103 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.