DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30090 and CG43125

DIOPT Version :9

Sequence 1:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:331 Identity:83/331 - (25%)
Similarity:123/331 - (37%) Gaps:123/331 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAAITALAIGVLCSL--GNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHS--SVKLIC 65
            ::|...||:..|...  |:..:||..|             |:.::.:..||:..|..  |..:.|
  Fly     1 MSATLRLAVFALLLFYQGSALFLEQNC-------------GKSSVFSPAPWLVKIRPELSSNITC 52

  Fly    66 GGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIK 130
            .||||.:|||||||.|::..:.:.|||||.|.|...  :||:   :.||..|..|..|..:|...
  Fly    53 TGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQN--SSKL---QYEEIYVARALIHRSYSSES 112

  Fly   131 NLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIE----------------------WF-- 171
            :..:||||||...|.:|.:|.||||.:...|.....:.|                      ||  
  Fly   113 HQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLS 177

  Fly   172 -----------------VATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRL 219
                             :|.||..|:        ||.:                           
  Fly   178 LFGVREPRPDVILPPQPIAVGWPLTK--------QINE--------------------------- 207

  Fly   220 GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGVYTDVYSYADWIATVVQQNTHVP 284
                      ..||.           |:|::|:.:.| |...|||||.:|.:|| |.:..:.|: 
  Fly   208 ----------SALFH-----------QYGILSHRNSE-SKKDVYTDVMAYVNWI-TPLALDVHI- 248

  Fly   285 APIMPN 290
             .:.||
  Fly   249 -TMAPN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 69/276 (25%)
Tryp_SPc 40..276 CDD:238113 71/278 (26%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 43/104 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.