DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and zgc:123295

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:273 Identity:86/273 - (31%)
Similarity:129/273 - (47%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VAANFLIPSCGVSYESNVA------TRIVRGKEAMLKSAPFMAYLY---YSSEIHCGGTIISSRY 79
            |....|:...|...:.||.      |:||.|:.|...|.|:...|.   |.... |||::|:..:
Zfish     9 VVGALLVNIAGSLCQLNVCGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGHF-CGGSLINKDW 72

  Fly    80 ILTAAHCMRP---YLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDR-FLANDIALL 140
            :|:||||.:.   .:.|:||...       |.|| :|......:|....:..::. ...|||||:
Zfish    73 VLSAAHCFQDSIGTIMVKLGLQS-------QSGS-NPYQITKTVVQVINHPNYNNPSNDNDIALV 129

  Fly   141 KLSRNIRFNVHIQPICLILNPAAAPNVHEFQAF----GWGQ--TETNHSANVLQTTVLTRYDNRH 199
            ||..::.||.:|:|:||    |||.|.:.....    |||:  :..|...::||...:....:..
Zfish   130 KLDSSVTFNDYIEPVCL----AAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSD 190

  Fly   200 CRSVLSMPITINQLCVGF---QGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS--P 259
            |:......||.|.:|.|.   .|.|:|.||||||:|::   :|. :::|.||||||....:.  |
Zfish   191 CKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSR---NGS-QWIQSGIVSFGRGCAEPGYP 251

  Fly   260 GVYTYVPNYIRWI 272
            |||..|..|..||
Zfish   252 GVYARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 78/245 (32%)
Tryp_SPc 45..273 CDD:238113 80/246 (33%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 78/245 (32%)
Tryp_SPc 36..264 CDD:238113 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.