DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG18754

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:303 Identity:91/303 - (30%)
Similarity:132/303 - (43%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IYICMCVCLVLQEQVAANFLIP---SCGVSYESNVATRIVR---GKEAMLKSAPFMAYLYYSSEI 68
            :|:|   |..|.:      ::|   :||.:      |.:.|   .:.|.|...|:|..|.|.:.:
  Fly    80 VYVC---CPELGD------VLPNKQTCGQT------TPVFRDRGAENAELNEYPWMVLLLYENRL 129

  Fly    69 HCGGTIISSRYILTAAHC-MRPYL--------KVRLGEHDITRNPDCQGGSCSPPAEEFDIVLAT 124
                ::|  ||:|||||| :..||        .|||||    ...||.......|..:.::...|
  Fly   130 ----SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGE----STTDCITSESRCPHLDVEVGQTT 184

  Fly   125 KYKRFDR---FLANDIALLKLSRNIRFNVHIQPICLI--------LNPAAAPNVHEFQAFGWGQT 178
            .::.|..   ...||||||:|...:|:...||||||:        ||         .|..||..|
  Fly   185 VHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLN---------LQISGWDPT 240

  Fly   179 ETNHSANVLQTTV--------LTRYDNRHCRSVLSMPITINQLCVGFQ-GSDTCSGDSGGPLVTK 234
            ::  |..::.:||        |.||.:....|         |:|.|.| ..|||:|.||.| |..
  Fly   241 KS--SQTLITSTVKERNPADCLNRYPSFRSAS---------QVCAGGQRKGDTCAGISGSP-VMG 293

  Fly   235 VNYDGVWRYLQL-GIVSFGDDKCQS---PGVYTYVPNYIRWIR 273
            :...||..::.| ||.|:|...|.|   |||||.:.::..||:
  Fly   294 IMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 81/263 (31%)
Tryp_SPc 45..273 CDD:238113 82/263 (31%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 2/6 (33%)
Tryp_SPc 108..338 CDD:238113 82/260 (32%)
Tryp_SPc 108..335 CDD:214473 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.