DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG18735

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:290 Identity:83/290 - (28%)
Similarity:131/290 - (45%) Gaps:66/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLQEQVAANFLIP--------SCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTII 75
            :|..:|.|.:..|        |||   ..|...|||.|:|..:...|:|..|.:....:||.:::
  Fly    52 ILGPEVPAEWSSPAKRECAECSCG---NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLV 113

  Fly    76 SSRYILTAAHCMRPY----LKVRLGEHD------------ITRNPDCQGGSCSPPAEEFDIVLAT 124
            :.:|.||||||:..:    :.|||.||:            ::|                 :::..
  Fly   114 NDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSR-----------------VLIHP 161

  Fly   125 KY--KRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAF--GWGQ-TETNHSA 184
            ||  :.||    :||||::.:..:|..:.:.|:|:   |..:.|.....|.  |||. :|....:
  Fly   162 KYSTRNFD----SDIALIRFNEPVRLGIDMHPVCM---PTPSENYAGQTAVVTGWGALSEGGPIS 219

  Fly   185 NVLQTTVLTRYDNRHCR--SVLSMPITINQLCVGF---QGSDTCSGDSGGPLVTKVNYDGVWRYL 244
            :.||...:.......||  :.....||.|.:|.|:   .|.|:|.||||||:....:.|.   |.
  Fly   220 DTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDA---YQ 281

  Fly   245 QLGIVSFGDD--KCQSPGVYTYVPNYIRWI 272
            ..||||:|:.  |..:|||||.|.::..||
  Fly   282 LAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 73/255 (29%)
Tryp_SPc 45..273 CDD:238113 74/256 (29%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/255 (29%)
Tryp_SPc 83..314 CDD:238113 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.