DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG34409

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:282 Identity:94/282 - (33%)
Similarity:126/282 - (44%) Gaps:64/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGVSYESNVATRIVRGKEAMLKSAPFMAYLYY----SSEI--HCGGTIISSRYILTAAHCMRPYL 91
            ||:    ||.:|::.|.:|.....|::..:.|    ||.|  .|.|::|||.:|:|||||:...:
  Fly   242 CGI----NVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLV 302

  Fly    92 K------VRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDR-FLANDIALLKLSRNIRFN 149
            .      ||||..|          ..:|.|.|..||    :..:|: ..|||||||:::..   |
  Fly   303 SDLELSHVRLGSQD----------GATPFAIEQVIV----HPNYDQPKYANDIALLRINST---N 350

  Fly   150 VHIQPICLILN-PAAAPNVHEFQ---AFGW--GQTETNHSANVLQTTVLTRY------DNRHCRS 202
            ....||||..| |....|....|   |.||  |.||.|.|.:...:|...|:      :...|..
  Fly   351 GTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAI 415

  Fly   203 V-------LSMPITI--NQLCV-GFQGSDTCSGDSGGPLVTKVNYDGVW----RYLQLGIVSFGD 253
            .       ...||.|  |.||. |...:|.|.||||||.:.. ...||:    ||..:|||:||.
  Fly   416 AYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDD-GTSGVFGTSGRYTIIGIVAFGP 479

  Fly   254 DKC---QSPGVYTYVPNYIRWI 272
            ..|   ..|||||.|.::..||
  Fly   480 TLCGVTTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 88/269 (33%)
Tryp_SPc 45..273 CDD:238113 89/270 (33%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 88/269 (33%)
Tryp_SPc 252..501 CDD:238113 87/266 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.