DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and zgc:112038

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:250 Identity:85/250 - (34%)
Similarity:129/250 - (51%) Gaps:35/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GKEAMLKSAPFMAYLY-YSSEIH-CGGTIISSRYILTAAHCM----RPYLKVRLGEHDIT-RNPD 105
            |.:|:..|.|:.|.:: .|.|.| |||::|:..::|:||||.    ...:|:.||....| .||:
Zfish    38 GDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITATANIKIFLGRQFQTGSNPN 102

  Fly   106 CQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVH-- 168
            ....:.:      .||:...|....:  .||||||:||.::.|..:|:|:||    |:|.:|.  
Zfish   103 EISRTLT------QIVIHPDYSTTTQ--NNDIALLRLSSSVTFTDYIRPVCL----ASADSVFAG 155

  Fly   169 --EFQAFGWGQTETN--HSANVLQTTVLTRYDNRHCRSVLSMPITINQLCVGFQ--GSDTCSGDS 227
              :....||.:..::  ...||||...|....|..|.:.....||.|.:|.|..  |.|.|.|||
Zfish   156 GTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKGIITDNMICAGINEGGKDACQGDS 220

  Fly   228 GGPLVTKVNYDGVWRYLQLGIVSFGDDKC---QSPGVYTYVPNYIRWIRYVMQSN 279
            |||:|::   :|. |::|.||||||.: |   :.||:||.|..|..||...:::|
Zfish   221 GGPMVSQ---NGS-RWIQSGIVSFGRE-CGLPRYPGIYTRVSQYQSWITSELRTN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 82/241 (34%)
Tryp_SPc 45..273 CDD:238113 83/242 (34%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 82/241 (34%)
Tryp_SPc 37..263 CDD:238113 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.