DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG11843

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:286 Identity:94/286 - (32%)
Similarity:136/286 - (47%) Gaps:45/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLQEQVAANFLIPSCGVSYESNVATR-------IVRGKEAMLKSAPFMAYL------YYSSEIHC 70
            |.:|::...||:|  |.|.||.:...       ||.|..|..:..|.||.|      ...::..|
  Fly    37 VFEERIEFGFLLP--GASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFC 99

  Fly    71 GGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLA-----TKYKRFD 130
            ||.:||.|::||||||    |:...||.::.|..:....|....|...|.::|     ..|:  |
  Fly   100 GGVLISERFVLTAAHC----LESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYE--D 158

  Fly   131 RFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQT--ETNHSANVLQTTVLT 193
            ....:||.|:||:..:.|:::..|.||......:.:  .|.|.|||.|  ....||.:|:.. |.
  Fly   159 PQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSD--SFIAVGWGSTGLALKPSAQLLKVK-LQ 220

  Fly   194 RYDNRHCRSVLSMPIT--------INQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIV 249
            ||.|..|:.:|:..:.        .||||||.: ..|||:|||||||: ..:.:....|:.:||.
  Fly   221 RYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLL-MYHREYPCMYVVVGIT 284

  Fly   250 SFGDDKCQS---PGVYTYVPNYIRWI 272
            |.| ..|.|   ||:||.|..|:.||
  Fly   285 SAG-LSCGSPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 83/259 (32%)
Tryp_SPc 45..273 CDD:238113 85/253 (34%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 85/253 (34%)
Tryp_SPc 68..309 CDD:214473 83/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.