DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG4815

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:64/269 - (23%)
Similarity:111/269 - (41%) Gaps:68/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVRGKEAMLKSAPFMA-YLYYSSEIHCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQ 107
            ||..|.:..::|...:. .|:...::.|..|:::.|:|||||||.....:.:.  |.|       
  Fly    34 RIYNGIKTTVESLGGVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKF--HVI------- 89

  Fly   108 GGSCSPPAEEFD-------------IVLATKYKRFDRFLANDIALLKLSRNIRFN-VHIQPIC-L 157
            ||.    :.||.             :.:..||.:. :|:| |:|:.|....:|.. :....:| .
  Fly    90 GGK----SAEFTWHGNNFNKNKLIRVQIHPKYAKM-KFIA-DVAVAKTKYPLRSKYIGYAQLCRS 148

  Fly   158 ILNPAAAPNVHEFQAFGWG---------QTETNHSANVLQTTVLTRYDNRHCRSVLSMPITINQL 213
            :|:|.     .:..|.|||         :.:|..|   ::..::::   |.|...|...:..|.:
  Fly   149 VLHPR-----DKLIAAGWGFEGGVWDESRKKTFRS---MKVGIVSK---RDCEKQLDRKMPPNII 202

  Fly   214 CVGFQGSDT-CSGDSGGPLVTKVNYDGV--WRYLQLGIVSFGDDKC---QSPGVYTYVPNYIRWI 272
            |.|...:.| |.|||||||:......|:  |.:           ||   :.|.||..|..|.::|
  Fly   203 CAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTF-----------KCGNNEKPDVYMGVRYYAKFI 256

  Fly   273 RYVMQSNGY 281
            :..:...|:
  Fly   257 KRTINRMGF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 62/258 (24%)
Tryp_SPc 45..273 CDD:238113 61/258 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 59/246 (24%)
Trypsin 49..256 CDD:278516 58/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.