DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG5909

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:268 Identity:91/268 - (33%)
Similarity:139/268 - (51%) Gaps:25/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS----SEIHCGGTIISSRYILTAAHCM--R 88
            :.:||    :....::..||.|.....|::|.|.|.    ....|||::||.|:|||||||:  :
  Fly   119 VTNCG----NKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQ 179

  Fly    89 P-YLKVRLGEHDITRNPDCQ--GGS---CSPPAEEFDIVLATKYKRF-DRFLANDIALLKLSRNI 146
            | .:.|||||||:....||.  ||:   |.||.||:.|.....:..: ...:::|:|::||.|.:
  Fly   180 PEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVV 244

  Fly   147 RFNVHIQPICLILNPAAAPNVHEFQAF---GWGQTETNHSANVLQTTVLTRYDNRHCRSVLSM-P 207
            :...||:|:||.:: ..:..:...|:|   |||.||....|..||..::||.....||...:. .
  Fly   245 KEKSHIKPVCLPID-QKSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGE 308

  Fly   208 ITINQLCVGFQG-SDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKC--QSPGVYTYVPNYI 269
            ::.|.:|....| ..||.||||||:..|..:...:|.:|.|:||||...|  ..|||:..|.:.:
  Fly   309 VSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVIDML 373

  Fly   270 RWIRYVMQ 277
            .||...:|
  Fly   374 PWITQNLQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 86/247 (35%)
Tryp_SPc 45..273 CDD:238113 87/247 (35%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 86/247 (35%)
Tryp_SPc 132..379 CDD:238113 88/247 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.