DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG11836

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:282 Identity:92/282 - (32%)
Similarity:137/282 - (48%) Gaps:51/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCG 71
            ::|:..|.|                .||.   ||...|||.||...:...|:||.:.|..:.|||
  Fly    78 NSSLKNCDC----------------DCGF---SNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCG 123

  Fly    72 GTIISSRYILTAAHCMRPY----LKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD-R 131
            |::::..|:|:||||::..    ::|..|:||.....:.|       |.:..:....|:|.|| .
  Fly   124 GSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQ-------AIQRAVTAVIKHKSFDPD 181

  Fly   132 FLANDIALLKLSRNIRFNVHIQPICL---ILNPAAAPNVHEFQAFGWGQT----ETNHSANVLQT 189
            ...||||||:|.:.|.|:..|:||||   ..:||.....    ..|||:|    |.....|.::.
  Fly   182 TYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGT----VVGWGRTSEGGELPSIVNQVKV 242

  Fly   190 TVLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDD 254
            .:::..:.|:.| ..|..||.:.||.|....|:|.|||||||:..   :|| :|..:||||:|..
  Fly   243 PIMSITECRNQR-YKSTRITSSMLCAGRPSMDSCQGDSGGPLLLS---NGV-KYFIVGIVSWGVG 302

  Fly   255 KCQS---PGVYTYVPNYIRWIR 273
             |..   ||||:.|..:|.||:
  Fly   303 -CGREGYPGVYSRVSKFIPWIK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 83/242 (34%)
Tryp_SPc 45..273 CDD:238113 83/242 (34%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.