DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG10232

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:294 Identity:105/294 - (35%)
Similarity:149/294 - (50%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSE------IH 69
            |||   |     ....|.|..|||   ::....|:..|..|.....|:||.|.|.:.      .:
  Fly   234 YIC---C-----PEPGNVLPTSCG---QAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNN 287

  Fly    70 CGGTIISSRYILTAAHC------------MRPYLKVRLGEHDITRNPDCQ-GGSCSPPAEEFDIV 121
            |.|::|:.||:||||||            :|   :|||||||||.||||. .|:|:.|..|..|.
  Fly   288 CSGSLINKRYVLTAAHCVVKDKMVNTDLVLR---RVRLGEHDITTNPDCDFTGNCAAPFVEIGIE 349

  Fly   122 LATKYKRF---DRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTET-NH 182
            ....::::   .|| .:||||::|...:|:...|.|||:..:|....| |..|..|||.|:. .:
  Fly   350 YFNVHEQYFNTSRF-ESDIALVRLQTPVRYTHEILPICVPKDPIPLHN-HPLQIAGWGYTKNREY 412

  Fly   183 SANVLQTTVLTRYDNR-HCRSVLSMPITINQLCV-GFQGSDTCSGDSGGPLVTKVNYDGVWRYLQ 245
            |..:|..||   |:|| :|:..:|.....:|:|. |.:|.|:|.|||||||:..:|.|    |..
  Fly   413 SQVLLHNTV---YENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNND----YQD 470

  Fly   246 L----GIVSFGDDKC--QSPGVYTYVPNYIRWIR 273
            :    ||||:|.:.|  :.|||||....:..||:
  Fly   471 IVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 94/258 (36%)
Tryp_SPc 45..273 CDD:238113 94/258 (36%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 95/257 (37%)
Tryp_SPc 260..503 CDD:214473 93/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463543
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.