DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and SPE

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:279 Identity:92/279 - (32%)
Similarity:134/279 - (48%) Gaps:40/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS---SE---IHCGGTIISSRYILTAAHCM--RP 89
            ||..:    |.||..|....|...|:|..|.|.   ||   .:|||.:::|||:|||.||:  |.
  Fly   127 CGFLF----ADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRE 187

  Fly    90 YLK-------VRLGEHDITRNPDC---QGGS--CSPPAEEFDI---VLATKYKRFDRFLANDIAL 139
            ..|       |||||.|...:|||   ..|.  |:|...:.::   ::...|........|||||
  Fly   188 LDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIAL 252

  Fly   140 LKLSRNIRFNVHIQPICLILNPAAAPNVHEF--QAFGWGQTET-NHSANVLQTTV----LTRYDN 197
            ::|.|.:.:..:::||||..:.....|..::  ...|||.||. ..||..|:.||    ||....
  Fly   253 VRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQE 317

  Fly   198 RHCRSVLSMPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS--- 258
            ::  |...:.:..:|:|.|.| |.|||.|||||||:..::..|...:...|:.|:|...|..   
  Fly   318 KY--SSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGW 380

  Fly   259 PGVYTYVPNYIRWIRYVMQ 277
            |||||....:|.||:..::
  Fly   381 PGVYTRTGAFIDWIKQKLE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 87/261 (33%)
Tryp_SPc 45..273 CDD:238113 87/261 (33%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 88/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463540
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.