DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG16710

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:285 Identity:96/285 - (33%)
Similarity:145/285 - (50%) Gaps:39/285 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSE----------IHCGGTIISSRYILTA 83
            ::|:..:......|.||..|:|......|:||.:.|:..          ..|.|::|::||:|||
  Fly    90 ILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTA 154

  Fly    84 AHCMR----PYLKVRLGEHDITRNPDC----QGGS-CSPPAEEFDIVLATKYKR---FDRFLAND 136
            |||:|    ...:||||||:|..||||    .|.. |:|...|.|:.|:.|::.   |:....||
  Fly   155 AHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYND 219

  Fly   137 IALLKLSRNIRFNVHIQPICLIL-----NPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYD 196
            ||||:|...:|:...|:|||:.|     ||:.:.  |:.|..|||.:.....:|||....:...:
  Fly   220 IALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSN--HKLQIAGWGLSHKQGYSNVLLQAYVNGRN 282

  Fly   197 NRHCRSVLSMP-ITINQ---LCVG-FQGSDTCSGDSGGPLVTKVNY-DGVWRYLQLGIVSFGDDK 255
            ...|.  ||.| :.:::   :|.| ..|:|||.|||||||:..:.. |..:.|| .||.|:|..:
  Fly   283 ADECS--LSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYL-AGITSYGYSQ 344

  Fly   256 C-QSPGVYTYVPNYIRWIRYVMQSN 279
            | ..|..||....::.||.:.|.:|
  Fly   345 CGYGPAAYTKTSKFVEWILWNMYTN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 90/261 (34%)
Tryp_SPc 45..273 CDD:238113 90/261 (34%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 90/261 (34%)
Tryp_SPc 106..362 CDD:238113 89/260 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.