DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG7142

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:325 Identity:81/325 - (24%)
Similarity:133/325 - (40%) Gaps:76/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VCLVLQEQVAANFLIPS---CG---------------VSY---ESNVAT-----------RIVRG 48
            :.:||....:.:..:|:   ||               .:|   |:.::|           :.:..
  Fly    19 IMVVLSSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAK 83

  Fly    49 KEAMLKSAPFMAYLYYSSE----IH-CGGTIISSRYILTAAHCMRPYLKVR-----LGEHDITRN 103
            :||...|||::..:...:.    :| |.||||:..:|||||||:.....|.     .|.|||   
  Fly    84 REATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDI--- 145

  Fly   104 PDCQGGSCSPPAEEFDIVLATKYKRFDRFLAN----DIALLKLSRNIRFNVHIQPICLILNPA-- 162
            .|.:|.:.:......|.     |.|.:.:|..    ||||:.....:.|:.::||..|   |.  
  Fly   146 HDQKGEASNIQMRHIDY-----YVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATL---PEQD 202

  Fly   163 AAPNVHEFQAFGWGQTETNHSANV---LQTTVLTRYDNRHCRSVLS---MPITINQLCVG--FQG 219
            |.|..:. ..:|||........|.   ||...:...|...|..:|:   :|:....||.|  ..|
  Fly   203 AQPEGYG-TLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGG 266

  Fly   220 SDTCSGDSGGPLVTKV---NYDGVWRYLQLGIVSFGDDKC---QSPGVYTYVPNYIRWIRYVMQS 278
            ...|:.||||||:.:.   :::..  .:.:||||:|...|   .:|.|:..|..:..||..|:.:
  Fly   267 VSICTADSGGPLIQQCCEEHFEQA--NIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIST 329

  Fly   279  278
              Fly   330  329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 70/257 (27%)
Tryp_SPc 45..273 CDD:238113 71/257 (28%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 72/255 (28%)
Tryp_SPc 84..323 CDD:214473 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.